| Basic Information | |
|---|---|
| Taxon OID | 3300007918 Open in IMG/M |
| Scaffold ID | Ga0111545_1008011 Open in IMG/M |
| Source Dataset Name | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Liverpool |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2216 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | United Kingdom | |||||||
| Coordinates | Lat. (o) | 54.9632021 | Long. (o) | -1.6348029 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025033 | Metagenome | 203 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0111545_10080112 | F025033 | N/A | MNHKKKRNRAIPIHITMPQTLLDDIDDQMSHKSSRSKWIRGACDLKLGKDVTQVADLTNIQLVNVLRNRCNYEGPGEAILKSLLEILSESS* |
| ⦗Top⦘ |