Scaffold Ga0111031_1122723

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0111031_1122723

Scaffold Ga0111031_1122723

Overview

Basic Information
Taxon OID	3300007900 Open in IMG/M
Scaffold ID	Ga0111031_1122723 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aarhus University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3048
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location Name	Aarhus Bay station M5
Coordinates	Lat. (^o)	56.10555	Long. (^o)	10.463333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102576	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111031_11227232	F102576	AGGAGG	MNDLLMLDKYFPGGTLDGGIELANRLDWGLTVKMAGLEYVVSSGDQPILRTDSKDALQTFIYGLGLAYAILPEELFLSLESALEEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.