Scaffold Ga0111031_1046374

Overview

Basic Information

• Taxon OID: 3300007900
• Scaffold ID: Ga0111031_1046374
• Source Dataset Name: Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aarhus University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1079
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium S5133MH4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location

• Location Name: Aarhus Bay station M5
• Coordinates
  • Lat. (^o): 56.10555
  • Long. (^o): 10.463333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092080	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111031_10463742	F092080	N/A	MVLKCIYILYKGGKRMQDKRVTIRIPFEIWKALRELQTVGKISSIQQAAVTGMNKLIESLKRGEEDNQRGAAKKRVLDVLVKEKPLGNWEDIHRERTEADADRS*