Scaffold Ga0111484_1004109

Overview

Basic Information

• Taxon OID: 3300007896
• Scaffold ID: Ga0111484_1004109
• Source Dataset Name: Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Liverpool
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3455
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanocellales → Methanocellaceae → Methanocella → Methanocella paludicola (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location

• Location Name: United Kingdom
• Coordinates
  • Lat. (^o): 54.9632021
  • Long. (^o): -1.6348029

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025653	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111484_10041095	F025653	N/A	MQKSGREVIGMSDPIKYFETKLKEMSLTELQAYKKRLDDSIQQKIMQTVPNEQIAPLILYRGILEHAIKTRINQR*