| Basic Information | |
|---|---|
| Taxon OID | 3300007873 Open in IMG/M |
| Scaffold ID | Ga0111036_100054 Open in IMG/M |
| Source Dataset Name | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Labidus sp. Gut microbial communities of Labidus sp. |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2610 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Neotropical Army Ants Gut → Army Ant Gut Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Monteverde, Costa Rica | |||||||
| Coordinates | Lat. (o) | 10.306961 | Long. (o) | -84.809844 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059647 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0111036_1000541 | F059647 | N/A | MASTGPVWPNVGNGGQIWSRISSLNELVHVKAELRDLGLVYQVIASTAL* |
| ⦗Top⦘ |