| Basic Information | |
|---|---|
| Taxon OID | 3300007864 Open in IMG/M |
| Scaffold ID | Ga0105749_1002266 Open in IMG/M |
| Source Dataset Name | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0um |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2848 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oregon, USA | |||||||
| Coordinates | Lat. (o) | 46.235 | Long. (o) | -123.9123 | Alt. (m) | Depth (m) | 10.3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007772 | Metagenome / Metatranscriptome | 345 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105749_10022662 | F007772 | N/A | MSNFSYTLLKISWRVYDKHYTKLTDEQKSNVLDIYYDFY* |
| ⦗Top⦘ |