Scaffold Ga0105744_1007642

Overview

Basic Information

• Taxon OID: 3300007863
• Scaffold ID: Ga0105744_1007642
• Source Dataset Name: Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2825
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location

• Location Name: Oregon, USA
• Coordinates
  • Lat. (^o): 46.2335
  • Long. (^o): -123.9142
  • Depth (m): 15.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019562	Metagenome / Metatranscriptome	229	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105744_10076422	F019562	AGG	MWYHKKFKLQYDKNVFNEIIEYAERATWKQGYDQNGLLWNVEELPLHPKQFPILNELYEGLNTEFKRPSFFISNVKPGGLVNHIDHNKWGNLGIPLKGDFKNTPQYFYDQFNHPVESFVVDSPVIFNTRMLHAVPRQLTDTGPRWVLMMDLFEWVDKLFDKIDDNTIWTDTKNFKNA*