| Basic Information | |
|---|---|
| Taxon OID | 3300007861 Open in IMG/M |
| Scaffold ID | Ga0105736_1067182 Open in IMG/M |
| Source Dataset Name | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 741 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oregon, USA | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9163 | Alt. (m) | Depth (m) | 9.6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003888 | Metagenome / Metatranscriptome | 463 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105736_10671822 | F003888 | N/A | MDVVNEIEVLESDVKDCNEKCQRVNCHAIYEAIMSSLKLLYDLIFMCCAKKKNEQ* |
| ⦗Top⦘ |