Scaffold Ga0105735_1010697

Overview

Basic Information

• Taxon OID: 3300007860
• Scaffold ID: Ga0105735_1010697
• Source Dataset Name: Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1511
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water → Microbial Communities From Columbia River Estuary, Oregon, Usa

Source Dataset Sampling Location

• Location Name: Oregon, USA
• Coordinates
  • Lat. (^o): 46.234
  • Long. (^o): -123.9163
  • Depth (m): 9.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058938	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105735_10106974	F058938	AGGTGG	MTHYDKTLITFHRGNAFSPEGITPAPFAILTINDLVDRELIDAICALVREHVNKAHADHCNIKFNLEDWDY*