NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104324_130467

Scaffold Ga0104324_130467


Overview

Basic Information
Taxon OID3300007820 Open in IMG/M
Scaffold IDGa0104324_130467 Open in IMG/M
Source Dataset NamePermafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2450
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location Namesvalbard,norway
CoordinatesLat. (o)78.11096Long. (o)15.55294Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003349Metagenome / Metatranscriptome492Y

Sequences

Protein IDFamilyRBSSequence
Ga0104324_1304672F003349N/AMLVAAPAALGATPQRIYRDYADNGRLDHKYSKADLQRAQKYAALQGYPQVGVQGAVEQALGAQAVKARGGLPFTGFDLALMAAGGALLLAAGTTLRKLSRARK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.