| Basic Information | |
|---|---|
| Taxon OID | 3300007820 Open in IMG/M |
| Scaffold ID | Ga0104324_107146 Open in IMG/M |
| Source Dataset Name | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Princeton University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1125 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | svalbard,norway | |||||||
| Coordinates | Lat. (o) | 78.11096 | Long. (o) | 15.55294 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021023 | Metagenome | 221 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104324_1071462 | F021023 | GAGG | MSEDKTIPISVIALRADDYSLDGKDVIISLTTKYSAAERKYLVPVECFHDLIVDLQRLNAAASATTSIETPIQPDVVPNPADDLNRFTVSA* |
| ⦗Top⦘ |