NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104322_147316

Scaffold Ga0104322_147316


Overview

Basic Information
Taxon OID3300007819 Open in IMG/M
Scaffold IDGa0104322_147316 Open in IMG/M
Source Dataset NamePermafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10965
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location NameSvalbard, Norway
CoordinatesLat. (o)78.11096Long. (o)15.55294Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053582Metagenome / Metatranscriptome141Y
F065182Metagenome / Metatranscriptome128Y
F073810Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0104322_14731616F065182AGGVVSLPANTPEKEKMKLNAYATSGTSPSKPDLICENHFSVFLLRPVSPSAFAWIEEHLPPDRLTFGNAVVVEPRYLWAILVGLQDDGLVVTRG*
Ga0104322_1473163F053582GGAVKKSDLLRALQTEIQNHNLSPFMSDKHKIVQTGCSICQKNFGTVEQFKRHLTEDVLPPLLDRLSTEKPSVI*
Ga0104322_1473168F073810GGAGGMSADRIVPVLLIGLLAFAALVPLGGNKNQTFDGVIVMNFGTYEFYSNAKDCNYRGTPYVVLPNERFRKSVTTGNTNIDDVDRLFHGTWRAKLNGNLSRIGWYKYRNTYWRELSVNYVVDAVLISCTAAR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.