NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104322_116717

Scaffold Ga0104322_116717


Overview

Basic Information
Taxon OID3300007819 Open in IMG/M
Scaffold IDGa0104322_116717 Open in IMG/M
Source Dataset NamePermafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1205
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location NameSvalbard, Norway
CoordinatesLat. (o)78.11096Long. (o)15.55294Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098272Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0104322_1167171F098272N/AGIFRFPTSQIESPDNFIDVGTGRHAKAIEGRWFGDLLVGSHFWQSLVVRVNKPFADDQIMRILDLPDEELAPAYRRQTVHRQLGTTFEFETTPRIVINDFFSISAQYVYRHKAQDHYTGTFTIPAAVTGSTDVNLDASTLDLETETKEHRVGGGLAWSNLYAFEQGKAKLPFEVTFLHWQTVQGWGGNQAKYFTDQVQVRLYMRLFGKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.