NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105679_10410303

Scaffold Ga0105679_10410303


Overview

Basic Information
Taxon OID3300007790 Open in IMG/M
Scaffold IDGa0105679_10410303 Open in IMG/M
Source Dataset NameMicrobial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1979
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Zebra Blood And Desert Soils. Microbial Community Dynamics Using Metagenomics And Cultivation

Source Dataset Sampling Location
Location NameEtosha National Park, Namibia
CoordinatesLat. (o)-19.03133Long. (o)15.54865Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015929Metagenome / Metatranscriptome251Y

Sequences

Protein IDFamilyRBSSequence
Ga0105679_104103032F015929GGAGGMTHDTRTFDRMGETTQTMVRTSQESARIFTDYTVKAQELNTQLARRAVETWIDGLRRQTELTQEVAQQLFGKAEEQADVYRSFFGQWGNVPAMRFPFAGVTNDFMFPFQRQGMRLVETGVRNAEEVIDTATFPISNYDQKNVEEISARLDGLSEDQIRRLRSYEKDHKNRQSLIERFDSKLRAS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.