Scaffold Ga0105679_10141204

Overview

Basic Information

• Taxon OID: 3300007790
• Scaffold ID: Ga0105679_10141204
• Source Dataset Name: Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1002
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Zebra Blood And Desert Soils. Microbial Community Dynamics Using Metagenomics And Cultivation

Source Dataset Sampling Location

• Location Name: Etosha National Park, Namibia
• Coordinates
  • Lat. (^o): -19.03133
  • Long. (^o): 15.54865

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066545	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105679_101412042	F066545	N/A	LIALAANVVFAAVLVGVVVALWPPPRPADPAPAIGEGRQPEAVVAGATEPDTALLTSTTARLEPGVLWLRQGSDGHVGDLFDAPGRWRISWSFNCKSFAKYGGGNFKLSGAGDFQDVSVQRVGSRGRGTLKVTGGGRGRLVIESVCDHWAVKAVAP*