| Basic Information | |
|---|---|
| Taxon OID | 3300007790 Open in IMG/M |
| Scaffold ID | Ga0105679_10081192 Open in IMG/M |
| Source Dataset Name | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwegian Sequencing Centre (NSC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1087 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Zebra Blood And Desert Soils. Microbial Community Dynamics Using Metagenomics And Cultivation |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Etosha National Park, Namibia | |||||||
| Coordinates | Lat. (o) | -19.03133 | Long. (o) | 15.54865 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007499 | Metagenome / Metatranscriptome | 350 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105679_100811922 | F007499 | AGAAGG | MYDVLVFDHRLAEHRPLDSKSELARLLFGYTTGNGQRFPAQPDLVRFVARPGGEVDIQHAMTGRDAIARAEGGETINFVYRAEGRRTEGSLARIGNGELRVR* |
| ⦗Top⦘ |