| Basic Information | |
|---|---|
| Taxon OID | 3300007777 Open in IMG/M |
| Scaffold ID | Ga0105711_1332537 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 646 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Rift Zone, Axial Seamount, northeast Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 46.0747 | Long. (o) | -129.995 | Alt. (m) | Depth (m) | 1716 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067114 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105711_13325371 | F067114 | N/A | NFVFYQTLQGFRFVSIETLMLGGFRLFKEKYENGAAVAQDYPHLATNAILETATNDKSSHIPIFKDDPEPVGNMKKFVVSYKYMPANMGEGKQSSYESVTSYRLTDSFETMKNVALGMYSNRVITHDLIQMKIDRRDFHYVTPPSSLSVIEADGSVSSKQNTEKGDPEKTQFDASVSTEIGRLCSDNADFLGKPEAHISLVPTTFGQAGALNKGP |
| ⦗Top⦘ |