NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105711_1150458

Scaffold Ga0105711_1150458


Overview

Basic Information
Taxon OID3300007777 Open in IMG/M
Scaffold IDGa0105711_1150458 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1179
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameNorth Rift Zone, Axial Seamount, northeast Pacific Ocean
CoordinatesLat. (o)46.0747Long. (o)-129.995Alt. (m)Depth (m)1716
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005149Metagenome / Metatranscriptome410Y
F033843Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0105711_11504583F005149AGGAMKTKCLLCTALTETGQGFYDHLEDVHMMPIRRMRFGDDGRPREESHSECMERFKFNHPEYGTEQCWCPDCIGGETLTMVNKICSKHGQLYIKGEHKNG*
Ga0105711_11504585F033843GAGMNKKKTLYWIVGLFVFFGWVDLVWGQTEKWSGESVTLYTTLIGFSMIDAKQTFMMDEYRSYFDRIEPITYAHEVNPLMGESPTNDRVVVVKLLTGVLTFYGLNKMKEVNRKKAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.