| Basic Information | |
|---|---|
| Taxon OID | 3300007777 Open in IMG/M |
| Scaffold ID | Ga0105711_1036720 Open in IMG/M |
| Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS918_NRZ_DNA CLC_assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 567 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Rift Zone, Axial Seamount, northeast Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 46.0747 | Long. (o) | -129.995 | Alt. (m) | Depth (m) | 1716 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001048 | Metagenome / Metatranscriptome | 793 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105711_10367202 | F001048 | N/A | MKIKSTKQFWWRLNHLKRNGGEITVTDRTPEMDVKEFNRIESLVNKRVRWELGSEGYSIWSECGYKDIPTLAKTYRIS* |
| ⦗Top⦘ |