Scaffold Ga0105672_1384174

Overview

Basic Information

• Taxon OID: 3300007772
• Scaffold ID: Ga0105672_1384174
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS914_Anemone_DNA CLC_assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 781
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Anemone Vent, Axial Seamount, northeast Pacific Ocean
• Coordinates
  • Lat. (^o): 45.933177
  • Long. (^o): -130.013868
  • Depth (m): 1541

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012162	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105672_13841742	F012162	N/A	LLTEEQTKYYLNDMIQHYREKESNTMGNLSWQRSVAEYRRKTFEDMRIVLFGDDDNENKRATIT*