Scaffold Ga0105668_1174585

Overview

Basic Information

• Taxon OID: 3300007758
• Scaffold ID: Ga0105668_1174585
• Source Dataset Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Marine Biological Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 607
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location

• Location Name: Axial Seamount, northeast Pacific Ocean
• Coordinates
  • Lat. (^o): 45.9372
  • Long. (^o): -130.082
  • Depth (m): 1500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074974	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105668_11745852	F074974	AGAAG	MKSPKRELPLDDLILQITKWKIEAASPYNDGWTQQHYQRMLDEVKLDLNKALREIEDGEELDNYD*