NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105668_1098244

Scaffold Ga0105668_1098244


Overview

Basic Information
Taxon OID3300007758 Open in IMG/M
Scaffold IDGa0105668_1098244 Open in IMG/M
Source Dataset NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)604
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Source Dataset Sampling Location
Location NameAxial Seamount, northeast Pacific Ocean
CoordinatesLat. (o)45.9372Long. (o)-130.082Alt. (m)Depth (m)1500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021553Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0105668_10982441F021553AGGAVSDTIRYKTVSLKNDIYSKLETMSGVLVEGVKLSIPQTIELLLKQEESNQELKSGWGK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.