Scaffold Ga0105547_1039080

Overview

Basic Information

• Taxon OID: 3300007750
• Scaffold ID: Ga0105547_1039080
• Source Dataset Name: Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', st44is 200bp-25jan2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1090
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge (Stylissa Sp.) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina (low pH), Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015565	Metagenome / Metatranscriptome	253	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105547_10390801	F015565	N/A	MLLYCAKTIVKESRKFELARLKKKKKGKHFGCLVTLWFGTFAMLFSATGCVVHHENTRR*