Scaffold Ga0104988_10024

Overview

Basic Information

• Taxon OID: 3300007735
• Scaffold ID: Ga0104988_10024
• Source Dataset Name: Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 10174
• Total Scaffold Genes: 18
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Gangwon-do, South Korea
• Coordinates
  • Lat. (^o): 37.953056
  • Long. (^o): 127.81721

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048175	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104988_100242	F048175	GAGG	MASGSFQFRYNHTNENAAWHTNPNAKFVLPEEDVDIRCDDPYLNETQFLEMVRRFFIACGYTEKQWKDALTTHLKQVENPE*