| Basic Information | |
|---|---|
| Taxon OID | 3300007734 Open in IMG/M |
| Scaffold ID | Ga0104986_1569 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chunlab, Inc |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 17861 |
| Total Scaffold Genes | 27 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (70.37%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gangwon-do, South Korea | |||||||
| Coordinates | Lat. (o) | 37.953056 | Long. (o) | 127.81721 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011282 | Metagenome | 292 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104986_156926 | F011282 | N/A | MKKIKNIVVITGTYTNREGVEKKRYQTIGSLFEDGENFKIKLDTIPLADGGWTGWANCYDLEEKTNKPEGKYDDTSIPF* |
| ⦗Top⦘ |