Scaffold Ga0102951_1025384

Overview

Basic Information

• Taxon OID: 3300007725
• Scaffold ID: Ga0102951_1025384
• Source Dataset Name: Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1850
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Algavirales → Phycodnaviridae → Prasinovirus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.496
  • Long. (^o): -122.1329
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033951	Metagenome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102951_10253843	F033951	N/A	MSAALLGAAVLCCCSSSSVAGAFLGGFIPDTPQFITKKMKKMIQTIITGDAKPVDCENLYKYMKEVGINPITDSAVQSLTANEKEIAGKIYDIGRAVAPEKICDKSVIDSAIKLFKDVENAPEGEDVSGFCNDLKELNNENQDERRPIYYWDESKKEFIKDNIYSSNAFGGKSGPEFQEPIIAKCNAVGINIR*