Basic Information | |
---|---|
Taxon OID | 3300007722 Open in IMG/M |
Scaffold ID | Ga0105051_11147041 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 553 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Fryxell | |||||||
Coordinates | Lat. (o) | -77.605 | Long. (o) | 163.163 | Alt. (m) | Depth (m) | 18 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F040481 | Metagenome | 161 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105051_111470411 | F040481 | GGA | VRKAFYILARRIFLKTILEDSAALKKRWRVDVSEILTMYLMTKNLVNHWDVIKDEFKKAKTLADKRLLITMMYQPWELCDDTFTEWSADNKITLPAKPTLRTVAAKYLYSD* |
⦗Top⦘ |