Basic Information | |
---|---|
Taxon OID | 3300007668 Open in IMG/M |
Scaffold ID | Ga0102935_1079111 Open in IMG/M |
Source Dataset Name | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D2_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1156 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South San Francisco, USA | |||||||
Coordinates | Lat. (o) | 37.4958 | Long. (o) | -122.1331 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088532 | Metagenome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102935_10791112 | F088532 | AGGA | MITLTLTEQETQALAGLLDAGVKAVGLRSVKDAASLLHKLEQATAPQEENDDE* |
⦗Top⦘ |