Scaffold Ga0102898_1004979

Overview

Basic Information

• Taxon OID: 3300007658
• Scaffold ID: Ga0102898_1004979
• Source Dataset Name: Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3051
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (22.22%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location

• Location Name: Columbia River Estuary, USA
• Coordinates
  • Lat. (^o): 46.2024
  • Long. (^o): -123.9409

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099304	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102898_10049791	F099304	N/A	TIEFVSDLTEAEVRQLLFEIYERVPIAGEDLSYAALPDKITRYVNETSRLFALEEAVTKYIVDECNNKDIGVQDPINLLLSSHKQLSRNIHEIYKEEY*