| Basic Information | |
|---|---|
| Taxon OID | 3300007635 Open in IMG/M |
| Scaffold ID | Ga0102925_1157109 Open in IMG/M |
| Source Dataset Name | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_A_D1_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 986 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Psychrobacter → unclassified Psychrobacter → Psychrobacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South San Francisco, USA | |||||||
| Coordinates | Lat. (o) | 37.4969 | Long. (o) | -122.1331 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000695 | Metagenome | 931 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102925_11571091 | F000695 | GGCGG | LIYAENFRAEEFREWADDISPRLVTMLDILRHRIGSPIVIS |
| ⦗Top⦘ |