| Basic Information | |
|---|---|
| Taxon OID | 3300007555 Open in IMG/M |
| Scaffold ID | Ga0102817_1013384 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1849 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured virus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River Estuary, USA | |||||||
| Coordinates | Lat. (o) | 46.2 | Long. (o) | -123.94 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011860 | Metagenome / Metatranscriptome | 286 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102817_10133842 | F011860 | N/A | MAKYKRQMNIAMERLDQGLARVHSLVKRGKNADAIHYMDNNLKELYGELQNIINVEPDNENPRVRGL* |
| ⦗Top⦘ |