Scaffold Ga0102934_1064875

Overview

Basic Information

• Taxon OID: 3300007537
• Scaffold ID: Ga0102934_1064875
• Source Dataset Name: Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_A_D1_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1843
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Pond Soil → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location

• Location Name: South San Francisco, USA
• Coordinates
  • Lat. (^o): 37.4958
  • Long. (^o): -122.1331
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018704	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102934_10648751	F018704	AGGAG	MSASNILAVTKTADGAAISGRTRVRGLYFTCSGTASSFSLKNGSTGAATALVTITTPAAAGGYDIHIPEEGFLFDAGVFVDVADAEVTSVTLMFEGGAAA*