Scaffold Ga0105054_10290876

Overview

Basic Information

• Taxon OID: 3300007520
• Scaffold ID: Ga0105054_10290876
• Source Dataset Name: Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1486
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Bonney
• Coordinates
  • Lat. (^o): -77.714
  • Long. (^o): 162.445
  • Depth (m): 83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036556	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105054_102908762	F036556	AGGTGG	MVITTTRVTQMHDIVETLQDRPESVKEILWSEGPWLGEELEKAWESYYEVQGYSPFATCGNDQCRSKDLCVLTSAVLPCTSPSSPLHAPFPPSTPGSQVPGVDSPCSPLHQVRGGVFPSRGNASKTRASLSQATVQQNRRELVAFCQQCWQFTNFRHNKGEIGILPLMVRLLIDTYRIAEHQPSRLRGELTSQEIKKYVKMCLKPGQQHRSG*