Scaffold Ga0105055_10000322

Overview

Basic Information

• Taxon OID: 3300007519
• Scaffold ID: Ga0105055_10000322
• Source Dataset Name: Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 71661
• Total Scaffold Genes: 87
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (17.24%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Bonney
• Coordinates
  • Lat. (^o): -77.714
  • Long. (^o): 162.445
  • Depth (m): 83

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102832	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105055_100003229	F102832	N/A	MPQLNKQAVMTSYYLVRYSGGSYENDFDVVIFTTSKKTTATKYCTKFNKILKKWKAYYKQFETQKYGIMTWISDEHIHTKFERWNKLSNISGCYWVEVSVR*