Scaffold Ga0105045_10279100

Overview

Basic Information

• Taxon OID: 3300007517
• Scaffold ID: Ga0105045_10279100
• Source Dataset Name: Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (megahit assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1309
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium B1(2017) (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Fryxell
• Coordinates
  • Lat. (^o): -77.605
  • Long. (^o): 163.163
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083734	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105045_102791003	F083734	N/A	ITKVLLQAGQDVVIFGCGSLSASVSAGQAPLGFWLLSFSFITLFISGWGRTQQ*