Scaffold Ga0105050_10071549

Overview

Basic Information

• Taxon OID: 3300007516
• Scaffold ID: Ga0105050_10071549
• Source Dataset Name: Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2385
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Colpodellida → Chromeraceae → Chromera → Chromera velia → Chromera velia CCMP2878 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location

• Location Name: Lake Fryxell, Antarctica
• Coordinates
  • Lat. (^o): -77.605
  • Long. (^o): 163.163
  • Depth (m): 18

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053085	Metagenome	141	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0105050_100715494	F053085	N/A	RLSMFELRETGDWDIFLGPPERARAETGGADQWVLTRREY*