NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105021_1118664

Scaffold Ga0105021_1118664


Overview

Basic Information
Taxon OID3300007515 Open in IMG/M
Scaffold IDGa0105021_1118664 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1598
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003515Metagenome / Metatranscriptome482Y
F003706Metagenome473N

Sequences

Protein IDFamilyRBSSequence
Ga0105021_11186643F003706AGGAMSEVSDVELGKLIQQISTLEVMVKEQNSRLDKLDQQLERTRGIGIGIVLATVGLSGIGGSLFTRWLSGGG*
Ga0105021_11186644F003515N/ANKDIEPKRKQNYTNTSSLIRLELMKRFLIALTAALAAFFTSAQAGPPEGMVRQMIPFPAMCLPATAAQNHFAVLMGALITDYGVHISMTFSSSPDQSQRVVIMENPHNGLAGVLMITDDQSCIAFSGEDRKVFVRPPDHPVGEMNKDTET*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.