NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105000_1033407

Scaffold Ga0105000_1033407


Overview

Basic Information
Taxon OID3300007511 Open in IMG/M
Scaffold IDGa0105000_1033407 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5479
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)267
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056608Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0105000_10334075F056608N/AMKDIGNLNNKDFGVQLDPNNNLKLVEDEDKGQKAYYKNKPMKYMDYMQEVSDRIIRNKQGKGVDNFGSFSGFGEGTLKKPYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.