Scaffold Ga0104751_1002575

Overview

Basic Information

• Taxon OID: 3300007351
• Scaffold ID: Ga0104751_1002575
• Source Dataset Name: Combined Assembly of Gp0115775, Gp0115815
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: National Aeronautics and Space Administration (NASA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 27760
• Total Scaffold Genes: 34
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 22 (64.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer → Sanford Underground Research Facility - Deep Subsurface Aquifer Microbial Community From Lead, South Dakota

Source Dataset Sampling Location

• Location Name: Lead, South Dakota, USA
• Coordinates
  • Lat. (^o): 44.03416667
  • Long. (^o): -103.76583333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050470	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104751_100257511	F050470	N/A	VGLATRGARNLTGKIEKIEDQDALAQVRRQARRVVFKAFLAAIPLTLIVFVLP*