NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102692_1588600

Scaffold Ga0102692_1588600


Overview

Basic Information
Taxon OID3300007321 Open in IMG/M
Scaffold IDGa0102692_1588600 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1266
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000645Metagenome / Metatranscriptome962Y
F005585Metagenome / Metatranscriptome395Y
F033029Metagenome / Metatranscriptome178N

Sequences

Protein IDFamilyRBSSequence
Ga0102692_15886001F005585N/AEGLSMETRGTIFYAFTKSREHSVFSSETHLNWHLLLLQQNSQEWWKVQSARIRISISLDTPLSWVDYDFQHQKIGTTLSLTRNHNTNQYCDYCKYRWGQNKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLEDAINDFAGREKLDVELP*
Ga0102692_15886002F000645GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADLHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKTKPSPKKAIETTKPALAQFIKEQRPNDPEPIVWDVSAIANQLGAEIIDEIPLCSGGDGPMVLKTGTKEGKEYRGWVCPTPKSGHPAKWMRIGSDGHWVFQK*
Ga0102692_15886003F033029N/AMKQDAHPFICSNCKLVTPHIELHKYDSTDIAEAPEEVWLVECQRCFMQRIIYPADRVTAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.