| Basic Information | |
|---|---|
| Taxon OID | 3300007291 Open in IMG/M |
| Scaffold ID | Ga0066367_1071210 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1253 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | -0.015038 | Long. (o) | -22.962334 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007053 | Metagenome / Metatranscriptome | 359 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066367_10712101 | F007053 | N/A | MANSITNRQGRSVLHIDTTDGAITLAELKATNEAAVVEAAIVEIFWQTAGSVTIDRGGTDVHAFTGTGHWNLTAAGTVLSGTNTDDIGITLSGDSYAIVIVHKSYSGG* |
| ⦗Top⦘ |