| Basic Information | |
|---|---|
| Taxon OID | 3300007289 Open in IMG/M |
| Scaffold ID | Ga0104734_1025113 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from aeration tank of chemical wastewater treatment plant in Ankleshwar, Gujarat, India ? sample Ank1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Xcelris Genomics |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2982 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aeration Tank Of Activted Sludge Process → Activated Sludge Process Metagenomes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gujarat, Ankleshwar, India | |||||||
| Coordinates | Lat. (o) | 21.6266027 | Long. (o) | 73.0119202 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104734_10251137 | F015419 | N/A | MKLELKITDEHGNEHLYNVVRSSSDEPKNLNDFILEALSISEDKRQLPFLIQCPNGLEVYPSIKMKFENYGSSLLGDKLEAMMVTWRD* |
| ⦗Top⦘ |