| Basic Information | |
|---|---|
| Taxon OID | 3300007286 Open in IMG/M |
| Scaffold ID | Ga0104348_1102834 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 1ppm of oxygen, sample A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Xcelris labs Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 571 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nagpur, India | |||||||
| Coordinates | Lat. (o) | 21.1458004 | Long. (o) | 79.0881546 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002401 | Metagenome / Metatranscriptome | 563 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104348_11028342 | F002401 | N/A | APKLDPATFPQGAIYVCASGAAPQRTITAIAFDEKAGKLCRRHPEMGPCQYERNLCRRSGGRVYAADGTEITMATEAEYDRKVMRVRFQAK* |
| ⦗Top⦘ |