Scaffold Ga0066366_10044134

Overview

Basic Information

• Taxon OID: 3300007283
• Scaffold ID: Ga0066366_10044134
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1578
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): -0.015038
  • Long. (^o): -22.962334

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038427	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066366_100441346	F038427	AGG	MSNNNIDFNDMTHDEVMSTIKEGLHYLTTTDLVSLHSEISRVQIEHSHKNEIEKEDG*