Scaffold Ga0101452_122741

Overview

Basic Information

• Taxon OID: 3300007280
• Scaffold ID: Ga0101452_122741
• Source Dataset Name: Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ18 time point
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Centre for Ecogenomics
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2841
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location

• Location Name: Port Hacking, Australia
• Coordinates
  • Lat. (^o): -34.1192
  • Long. (^o): 151.2267
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065138	Metagenome / Metatranscriptome	128	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101452_1227412	F065138	AGAAG	MRYTDLFEISVVDSKVIDLLSILSSEGVESIPLDTLVGELVKMGVDVDDQSLFDELDNIPIVNNIKDGIVYFNTASMGASNLNKVDPEKNKKKVKAMAKKQVDKELSK*