| Basic Information | |
|---|---|
| Taxon OID | 3300007265 Open in IMG/M |
| Scaffold ID | Ga0099794_10003559 Open in IMG/M |
| Source Dataset Name | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5965 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → Methanomassiliicoccaceae → Methanomassiliicoccus → Methanomassiliicoccus luminyensis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, Eel River Critical Zone Observatory | |||||||
| Coordinates | Lat. (o) | 39.7291 | Long. (o) | -123.6419 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045646 | Metagenome / Metatranscriptome | 152 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099794_100035592 | F045646 | N/A | MYMPRPRTPDYVGLFGVAFFLLVLGIAFYLNGNLLTELRRWWDQVLAGRGAFRPPEGVIISAGLFWGLLGVSNFGIAFLRWFFTRSRIRTLGAILGGIAMVMFSYFLYRYSVRDMSGSLVVALEAGVIAVLLFIYIGAGLYWTTPRYRPAYQGVYRAPRP* |
| ⦗Top⦘ |