| Basic Information | |
|---|---|
| Taxon OID | 3300007248 Open in IMG/M |
| Scaffold ID | Ga0075168_1675523 Open in IMG/M |
| Source Dataset Name | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 D RNA (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 614 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Milwaukee, Wisconsin, USA | |||||||
| Coordinates | Lat. (o) | 43.023 | Long. (o) | -87.895 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019603 | Metagenome / Metatranscriptome | 228 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075168_16755231 | F019603 | N/A | MKAILVLLISLAIVYCATPAQPSFPTSFNAEVSRYRAGQRPVTGEWYYSVALNAERFDFDLIDHNDQPVHEAFYALHNESYGYLMSTAGGAFKCRRFNIGTRVFTPQLSNFSYQGLEVFQLNIPTPAYHWSNPNKTDELQQYFNSVVAQSNPVRVDRVYNKKIDQYTFWTVNLGPQDITLFQIPIKMY* |
| ⦗Top⦘ |