Basic Information | |
---|---|
Taxon OID | 3300007230 Open in IMG/M |
Scaffold ID | Ga0075179_1588430 Open in IMG/M |
Source Dataset Name | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C RNA (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 550 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent → Wastewater Effluent Complex Algal Communities From Wisconsin, To Seasonally Profile Nutrient Transformation And Carbon Sequestration |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Milwaukee, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.023 | Long. (o) | -87.895 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038410 | Metagenome / Metatranscriptome | 166 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075179_15884301 | F038410 | N/A | MYQTLGVMRPVFSRFVGVSNGPLNYSGLYLWFFLTVGIISKFRFTRGRDLLFFNAQDQPEFWYARYNMMFPPSFLHNRISAHYIEINHIFAIEMLKRYQLARRELIAEREKHSDFEKRTKYITNSNYVYEPLGADDDKIKRMKDDGEF* |
⦗Top⦘ |