 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007216 Open in IMG/M |
| Scaffold ID | Ga0103961_1313759 Open in IMG/M |
| Source Dataset Name | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2947 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.409238 | Long. (o) | 103.907928 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012447 | Metagenome | 280 | Y |
| F023328 | Metagenome | 210 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103961_13137591 | F023328 | GAG | MTNYTPEYKVTINGVEQTSVTLTNGSITFGRNDFFEPTQPSYCNLELLNLDGTSPDIGLLDAVIIEVKDTTGAWVKLFTGEVSGVYNRIAAAGVAGQPNTMQIQAVGALGLLVKRNAGGVAYPQELDGERIQRILEETLYTAWEDLSNTLTWNDIDASVTWQNYGVQGIDVIDVGRYEVLARSAEIVPAYTLTDLTSNTGLGYLYETTAGNIGYADAERRSENYALNQINLDADLLNADIATRLQTADIVNSVVIQYDDPVQEVGAENPTSINDYGLLQDVRSTILAETADATEQAANFVNYRGTPRTSLEEISLNLANGSMSDATRNALLDVSMDSLISLSNLP |
| Ga0103961_13137593 | F012447 | GGA | MAKPLRLVPVDKDYRALLRTFGKMDDIAKNDMKDIAKQLAERGSAYAKGAASTAPYNKRQALAVAESIRISKSDKAPSFSIGGRQRVSSSAFSAGYVIMGNEFGSNRLKQFPPRSPRQGRGNRGWWLYPSMSRFHPTIAKEWLAGFQKVRDAWTGRI* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |