Scaffold Ga0103961_1260514

Overview

Basic Information

• Taxon OID: 3300007216
• Scaffold ID: Ga0103961_1260514
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1419
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.409238
  • Long. (^o): 103.907928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097447	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103961_12605142	F097447	GGAGG	MAIPGVKTLIRDRFYSVSRQDTPVGPRIVAIARRSTASGTGSIADLDVVRTTNEADVISAFGDGSDAHRAYLELILAGAGRIYIVPLPSDTTFNSSTGAVESATYGGSVFDAAFSAAEAAIPDIIVPWGRGGHPNEWAATPSTPERGFYADNSTTVTSNWAYKIAAKVKEISENINPCIAVLGVKPYAGTSESMTPGQVSTHLGLTNLPDRDASSLLKEVGPYVVVVASEVKPVNYESGTTDFGYSNGAAHVAGALSIIPSYSSLVNKALYNVEALRYAPSRTQQSTLGGKGVNTVVVNFNKIPVFGEGLTFAWSTSDYTRLSTKRIVDDATAVVRQACQRFVGEPSNIQTRNAMETAITSGLRGMQIVGAL